How You Can And Cannot Feed Chinchilla

Contents

What branches can be given to chinchilla (trees)

How You Can And Cannot Feed Chinchilla

The diet of rodents should be diverse, so you need to add greens and young shoots to it. However, before filling the feeder, you should understand which branches can be given to the chinchilla. Not every tree or shrub will have a beneficial effect on the pet.

Raw Material Harvesting Rules

The need to introduce various shoots and twigs into the diet of rodents is due to several factors:

Features of the harvesting of green feed at home:

  • The collection of branches is possible only in ecologically clean areas, far from highways, densely populated areas, industrial enterprises;
  • The optimal time for collecting wood and foliage is the growing season;
  • It is necessary to verify the absence of moldy parts, lichens, traces of pests and fungus;
  • At home, each rod must be washed successively with hot and cold water, dried;
  • Store in a place with minimal moisture content;
  • Bark on the rods should be left – it contains the maximum concentration of nutrients.

What branches can be given to chinchillas

Shrubs and trees can not be offered chinchillas constantly. Depending on which branches and twigs are abundant, the diet should be planned as follows:

  • Hawthorn – before feeding, remove leaves and thorns, give 1-2 branches per week;
  • Guelder-rose – 2 pieces every 7 days;
  • Gooseberries – 3 branches per week, previously cleared of thorns;
  • Raspberry – also peeling off anything that could damage the animal, 1 twig should be relied upon once every 2 weeks;
  • Sea buckthorn – remove leaves, give on a branch 1-2 times a week;
  • Mountain ash – the method is similar to sea buckthorn;
  • Currants – supposed to distribute 3 pieces per week diet;
  • Mulberry – you can pamper your pet once a week with 1 little thing;
  • Alder – effective for diarrhea, if you feed the animal of 1 twig every 7 days;
  • Birch – a regimen similar to alder;
  • Willow – it is not recommended to exceed the dose of 1 twig for 2 weeks;
  • Elm – on the shoot every 3 days;
  • Pear – it is allowed to give 2 branches up to 3 times a week;
  • Willow – can be given with the same frequency as a pear;
  • Linden – can be constantly kept in a cage;
  • Hazel – a branch twice a week;
  • Aspen – 1 rod 2-3 times a week.
How You Can And Cannot Feed Chinchilla

You need to know which branches and in what form to give the chinchilla

Harmful chinchilla branches

Veterinarians and zoologists identify many types of plants that can be given to rodents to improve health. However, there are varieties that are absolutely impossible for chinchillas. Among them:

  • All species of conifers;
  • Citrus trees;
  • Apricot, plum, cherry;
  • Wood of any kind with resinous wood;
  • Lilac, buckthorn;
  • Bird cherry, elderberry, maple.

Knowing exactly what chinchillas eat, you can independently prepare for them a varied green menu and often the joy of a pet with a new treat that will bring only benefit.

Video: twigs for chinchilla how to store and how much to give

The branches of which trees can be given to chinchillas

Please rate the article

Share with friends

How you can and cannot feed chinchilla. Lists of healthy and harmful foods

Chinchillas, although they belong to rodents, are not omnivorous. When buying a small animal, it is necessary to understand that its health will completely depend not only on the correct conditions of detention, but also on proper feeding. Therefore, each breeder should be aware of what can be given to chinchillas, and what foods are prohibited and even dangerous.

Prohibited Products

Persimmons are forbidden for feeding. This fruit useful for humans is rich in iodine, which is contraindicated in animals. In addition to iodine, persimmon contains a lot of sugar and astringents, which will lead to constipation.

It is not recommended to give chinchillas and beets.

How You Can And Cannot Feed Chinchilla

When harvesting tree branches for the winter, it is worth remembering which species are dangerous and unsuitable for feeding. The branches of which trees can not be harvested:

  • Apricot
  • Acacia white,
  • Buka
  • Ashen maple,
  • Buckthorn
  • Cedar
  • Chestnut
  • Branches of any citrus species,
  • Cypress
  • Elderberries
  • Cherries
  • Sweet Cherries
  • Branches of any conifers,
  • Holly
  • Hydrangeas
  • Juniper
  • Common maple
  • Myrtle,
  • Oleander
  • Plums.

Oak bark and twigs can only be given to animals suffering from diarrhea. In healthy animals, they cause severe constipation.

How You Can And Cannot Feed Chinchilla

Branches of stone fruit trees (cherries, cherries, plums, etc.) are dangerous because they contain a dangerous cyanide compound, as a result of the splitting of which hydrocyanic acid is formed in the chinchilla’s body. If you feed the animal with such branches – you can get not only the strongest poisoning, but also the quick death of the pet.

Any kind of honey, as well as purchased cottage cheese and sour-milk products, is also a prohibited product.

Not all breeders know that you can’t give chinchillas leaves, stems and flowers of indoor plants. Most of them are poisonous to the animal and very often cause death.

How You Can And Cannot Feed Chinchilla

It is also not recommended to give any food from the person’s table. Everything that is normal and familiar, even useful for people – for the chinchilla becomes the cause of digestive problems, allergies, obesity and other serious diseases. The animal will never give up tasty and fragrant food and can eat both a slice of cake and cheese, meat or fish. However, such food is not normal and familiar to the stomach of a furry pet. And the possible consequences are very sad.

Foods that can be given in limited quantities

Many breeders argue about the need or the possibility of feeding the animal of these types of products. However, in small quantities, they bring more benefits.

The first such product is nuts. Chinchillas simply adore them. Nuts contain many beneficial trace elements, vitamins, acids and amino acids. The danger is that nuts can cause allergies, diarrhea and provoke the development of obesity. However, once a week, you can offer your pet a delicious treat – walnuts, almonds, peanuts or hazelnuts. The main thing – there should be only one nut.

A lot of controversy arises about seeds. They contain a large amount of fatty acids and those involved in breeding and exhibitions know what positive effects seeds have on the condition of the fur and the appearance of the animal. However, an excess of seeds in the diet can lead to obesity and problems in the stomach. Chinchillas can be given a few seeds of pumpkin or watermelon, sunflower or flax. It is very important to remember that seeds must be fresh. Fried sunflower seeds – pumpkin or sunflower – will cause constipation and poisoning.

Read more:  How To Care For Chinchilla

How You Can And Cannot Feed Chinchilla

Dried fruits are most often used as goodies. If you really want to treat the animal with a piece of raisins or dried apricots – we give no more than once a week and only in small quantities.

Any type of dried fruit has a number of very useful substances for humans, but they are not quite suitable for chinchillas. Raisins are too sweet and can cause sugar problems. Most often, raisins are given to sick animals that refuse to eat or to a just born female. Prunes have a strong laxative effect and you can give a small piece only with constipation.

It is better not to give candied fruits and berries – animals eat them with great joy, but such products contain too much sugar and too few healthy ingredients. You can treat your pet with canned pineapple or papaya. However, it is better to avoid such experiments. Chinchilla intestines are very tender and no one can predict in advance about the reaction to a new kind of goodies.

How You Can And Cannot Feed Chinchilla

Breeders also argue about the acceptability of feeding crackers. It is not recommended to give fresh bread to animals – it often leads to the formation of gases, but fresh crackers, especially from yeast-free bread, can be a good treat.

Allowed Products

The list of products that can be given to chinchillas is quite large. Animals can be fed fruits:

  • Bananas
  • Apples
  • Pears
  • Figs
  • Vegetables:
  • Pumpkin,
  • Dairy corn
  • Bell pepper,
  • Kohlrabi,
  • Zucchini
  • Zucchini,
  • Kohlrabi,
  • Squash,
  • Ripe red tomatoes.

How You Can And Cannot Feed Chinchilla

How You Can And Cannot Feed Chinchilla

Greenery:

  • Lettuce leaves
  • Spinach leaves
  • Clover,
  • Alfalfa,
  • Sorrel leaves
  • Leaves and stalks of dandelion,
  • Celery,
  • Chicory,
  • Cornflowers
  • Vika,
  • Common nettle
  • Sagebrush,
  • Raspberry leaves and stalks,
  • Strawberry leaves and stalks,
  • Plant tops,
  • Sprigs with leaves of apple, pear,
  • Birch and linden branches,
  • Hazelnut twigs.
  • Corn (corn grains are part of the feed mixture and are given in ground form),
  • Barley (give ground)
  • Wheat (grains and bran),
  • Oats (grains, bran, cereal),
  • Millet,
  • Buckwheat,
  • Fig.

How You Can And Cannot Feed Chinchilla

Apples, pears, as well as carrots, pumpkins, zucchini, berries – you can give animals both fresh and dried.

Some chinchillas are more likely to eat dried foods, moreover, they are safer for the digestive tract.

Fresh grass for furry pets is recommended to be collected in places remote from roads and dumps, walking pets and industrial enterprises. It is not recommended to feed grass moist from dew or rain. And also carefully monitor that poisonous plants are not caught among other herbs.

Feeding advice

In catering, it is not enough to know how to feed chinchilla and what cannot. Proper feeding is also the observance of the diet, maintaining clean feeders and drinkers, as well as an understanding of the digestion of the animal. The first and most important rule – there should always be hay in the cage, as well as drinking water. Feeders and drinkers should be kept clean. To do this, they should be disinfected with boiling water regularly (at least twice a week). Wooden feeders are better not to use – they absorb odors, become sources of mold and mildew. Preference should be given to ceramic, which are perfectly attached to the cage and easy to clean.

Chlorhexidine can be a disinfectant for the whole cell – it kills microbes well and has no smell, but it is better not to use it for drinkers and feeders. Some breeders use ordinary household soap as a disinfectant. You can wipe the drinkers and feeders, as well as the cage with alcohol. It is also necessary to monitor the purity of the cage because sometimes the animal prefers to eat on the resting area or even in the house. Many owners noticed how the chinchilla takes a piece of feed and runs into shelter.

How You Can And Cannot Feed Chinchilla

Vegetables and fruits intended for chinchillas must be washed and cut into convenient small pieces.

It is necessary to feed the pet at the same time, and all the rest of the food is removed from the feeder the next day. It is most preferable to give roughage in the evening and juicy in the morning. If the chinchilla reluctantly eats – you should change the feed. The first reason for poor appetite is a monotonous meal. New types of feed should be introduced gradually and little by little. If there is no certainty whether one or another type of product can be chinchillas, it is better to abandon it altogether and add something that the animal has already tried and eats with pleasure.

Read also

What can be given to chinchillas in addition to dried fruits, food, all kinds of fried nuts, what else can you give?

First of all, chinchillas belong to herbivorous rodents. But unlike their close relatives, guinea pigs, these animals eat very little. At the same time, indefatigable energy and chic fur require a large consumption of nutrients. Food for them should be high-calorie, contain a lot of protein and carbohydrates. What foods can be given to chinchilla. 1. Rough feed. This is hay, twig feed, tree bark. 2. Concentrates. These are grain feeds, legumes, seeds, cereals, bran, bread. Ready-made feed for chinchillas can also be referred to concentrates, many of which, in addition to grain, contain other components. 3. Succulent feed. Chinchillas can be given cucumbers, tomatoes, zucchini, pumpkin, carrots, Jerusalem artichoke, kohlrabi, salad; from fruits – apples, pears, figs, bananas, grapes, BERRIES. Large fruits are preferably cut into small pieces. Greens: wheat grass, clover, knotweed, dandelion, dioica nettle, alfalfa, vegetable tops (carrots, turnips, Jerusalem artichoke, peas), branches of fruit trees with leaves. All these feeds can be given ad libitum, but keep in mind that they deteriorate very quickly. 4. Animal feed. For example, whey, skim milk, yogurt, meat and bone meal. 5. Vitamin and mineral top dressing. IMPORTANT! Chinchillas should not be given cookies, sweet buns with vanilla, fried seeds and nuts, granola with a high content of various additives. All this animal can eat with pleasure and not even die after the first time. But subsequently feeding such goodies can seriously affect the health of the animal. Currently, they produce many tasty treats intended specifically for rodents.

Nuts, especially fried, are not allowed! Salted seeds too. Be sure to give hay and FRESH fruits.

Read more:  Is It Worth Getting A Chinchilla At Home

Fried crackers are not allowed. But nuts can only be walnuts and then in small quantities as a treat.

If you are really interested, then hammer in the search engine "chinchilla forum". Or follow the link [the link will appear after checking by the moderator]. Everything is described in detail there, many different interesting topics about feeding, etc.

You can give vegetables, but in no case not fresh! You can dry a cucumber, carrot, tomato, Jerusalem artichoke and pumpkin! (but not in large quantities). As a treat, you can give dried leaves of raspberries, apple trees, grapes, pears! But you can not give twigs and leaves of trees that secrete resin. This is apricot, oak, cherry! You can give nuts, but not fried! There should always be hay and crops! Two chinchillas themselves! Two boys Lucky and Tim) eat the same diet and everything is fine) I hope it helped, I wish you and your Shushka health and happiness!

Branches for chinchilla. what can and cannot be chinchilla

In this section, we give examples of shrubs and trees whose branches can be introduced into the diet, as well as examples of those plants that are undesirable when feeding animal chinchillas.

Introduction to the daily diet of branches, twigs, snags and pieces of wood of different tree species is simply necessary for the healthy and full development and existence of chinchillas. The wood of various species of shrubs and trees contains a large amount of natural vitamins and minerals necessary for the animal, and the use of whole wood when feeding favorably affects the formation and structure of the chinchilla’s dental system. Chinchillas play well with pieces of wood and ingots, which also positively affects their behavior.

How You Can And Cannot Feed Chinchilla

Chinchillas with pleasure eat branches, leaves and bark of such species of shrubs and trees as hazel (hazelnut), apple tree, acacia, willow, raspberry, linden, rose hip, hibiscus, willow.

You can also include branches and foliage of pear, mountain ash, blackcurrant, birch, sea buckthorn, chestnut, hawthorn, alder, and hazel in the diet of chinchillas.

If you take on your own to harvest branches, foliage bark, etc., then take note of the following information:

  • Procurement material cannot be cut within the city, in parks, along roads;
  • Foliage and wood should be harvested during the growing season, in ecologically clean areas;
  • On the branches there should not be mold, lichens, traces of infection with a fungus, pests;
  • The branches should be washed first under hot water, then under cold, and then dry well.
  • Do not remove the bark from the trunk of twigs, ingots, as it is the main source of nutritional value of wood feed.

Now we will list the species of trees and shrubs that are forbidden to give chinchillas, these are:

  • All types of conifers;
  • Citrus;
  • Plum, cherry, apricot and other types of fruit trees with resinous wood;
  • Shrubs – wolf bast, wild rosemary, lilac, buckthorn, bird cherry, elderberry and maple.
  • Replies: Mail.Ru: can a chinchillas pear?

    Can. I think that from a pear to whom it does not fall =)

    Of course, more fruit for them) If you feed with dry food, your stomach will clog

    Yes. You can pear. You can still grapes, but in a day Do not blow a lot of sweet treats: raisins, dried peaches. You can blow. You can various vegetables, fruits and herbs. Here you will have to choose those that your pet will like. Some of the succulent feeds can become favorite treats, and some animals will not even be touched. Chinchillas have everything individually. Chinchillas can be given cucumbers, tomatoes, zucchini, pumpkin, carrots, Jerusalem artichoke, kohlrabi, salad; from fruits – apples, pears, figs, bananas, grapes, berries. Large fruits are preferably cut into small pieces. Greens: wheat grass, clover, knotweed, dandelion, dioica nettle, alfalfa, vegetable tops (carrots, turnips, Jerusalem artichoke, peas), branches of fruit trees with leaves. All these feeds can be given ad libitum, but keep in mind that they deteriorate very quickly. Like rabbits, chinchillas are undesirable to give white, red, cauliflower, red beets. These foods can cause gastrointestinal illnesses.

    Leaves of trees for chinchillas, herbs

    Among the tree species, various parts of which can be fed chinchillas, the following can be distinguished.

    Birch tree. Its leaves and branches are rich in vitamins, sugars. They contain many volatile, substances with antimicrobial properties. Animals that are bred in captivity usually lack them, especially young animals.

    In young leaves of birch there is a lot of ascorbic acid (vitamin C) in the kidneys. vegetable fats and other valuable substances.

    In the leaves, substances were found that stimulate the vital processes of animal organisms, resembling in their composition similar substances of ginseng. Birch branches and leaves collected in summer and winter can be fed to chinchillas throughout the year.

    Oak. Acorns and oak branches attract the attention of chinchillas throughout the year. They are very nutritious. In addition, they are useful for indigestion of animals (diarrhea) because They contain tannins. But in constant and large quantities can cause constipation.

    Willow. Different types of willows. Valuable feed product readily eaten by chinchillas. Leaves and branches are fed to animals all year round. The most nutritious branches are cut during the winter.

    Aspen. Leaves, bark and young shoots of aspen can serve as an addition to chinchilla food in all seasons. They need to be harvested in winter, since during this period they have much more fat and protein.

    Juniper. The needles and berries of this small tree. useful and attractive food for chinchilla. Berries contain up to 40% of sugars, they have bactericidal properties.

    Pine. In the needles of this tree about 3% fat, up to 20% starch. In addition, it contains a significant amount of iron, an element that is part of the hemoglobin of blood, found special bitter-smelling substances that stimulate appetite in animals. Pine needles are known for their high vitamin content. Especially in the needles of vitamin C. Ascorbic acid is six times more than in lemons or oranges. The animals are fed primarily spring young shoots. Chinchilla pine seeds are readily eaten throughout the year. Branches should be clean of resin.

    Poplar. By nutrition, poplar leaves are superior to the best fodder herbs and are an excellent fodder. However, chinchillas eat them badly.

    In addition to the above plants, animals consume leaves, shoots and bark of pear, apple, linden, hazel, blackberry, raspberry, sea buckthorn, etc.

    (S.V. Romanov-Ilyinsky. "Chinchilla")

    As a branch feed, you can not feed branches of apricot, rosemary, elderberry, wolf bast (wolfberry), buckthorn, almond, poison sumac, bird cherry, as they contain toxic substances. When giving branches of oak and alder, it should be borne in mind that they contain a lot of tannins (tannin), so it is advisable to feed them to animals as a fixing agent for digestive disorders. Large amounts of birch branches can lead to kidney inflammation.

    Read more:  Instructions For Feeding Chinchillas At Home Create A Tasty And Healthy Diet

    (SP Bondarenko. "Diseases of fur animals.")

    Green feeds – grass and tree leaves – should be no more than a quarter of the daily diet of chinchillas (it is recommended to learn 1 blade of grass a day, and preferably dried, because it causes digestive upset, diarrhea).

    Particular attention when feeding requires young animals. Until the calves reach the age of 1.5 months, it is not recommended to include green and juicy foods in their diet, although a healthy piece of the green leaf taken from the parents will not bring harm to healthy babies. From the age of six weeks, cubs begin to eat green feed, which is introduced gradually into the diet and gradually increase the serving.

    Tea. Chinchillas are very fond of dry tea leaves. You can give green tea, and black, and mate, but always natural, without artificial flavors. Remember also that tea contains tannins, which have firming properties. Therefore, give a serving of tea no more than 1/3 teaspoon no more than three times a week. It is good to combine tea leaves and dry petals of Sudanese roses ("hibiscus"), which have a mild laxative effect.

    Rosehip buds and wrinkled roses. 4-5 pcs. Strawberry and strawberry leaves – several each.

    Dried berries and fruits.

    Rosehip – peel indefinitely, and give only the peel, and to destroy the seeds and remove! Many cases of gum injury with spikes of seeds! If you notice tears that the chinchilla refuses food. most often it is gum disease (stomatitis). Treat the gums with Metrogil Dent ointment.

    Blueberries – several berries per day, because Dried berries have firming properties.

    Raisins – 1 pc. Once a week, during recovery or to lactating and pregnant females, sweet dried fruits. in the daily diet is FORBIDDEN! Cause insulin shock \ to whom!

    Drying apples. 1p in d useful vitamin C.

    Chinchillas are very fond of Hercules, which has a high taste and is a source of B vitamins. All the chinchillas I know are ready to sell homeland for Hercules, but you can give it only 1 teaspoon per day. Hercules should be absolutely clean, dry and crumbly, without strangers inclusions and impurities, without mold, etc. Even better if it is a mixture of several cereals in the form of flakes.

    Germinated grains of cereal plants.

    Germinated grain is very useful for animals, especially young animals. In winter and early spring you can give germinated grain at the rate of 10 – 15% of the daily norm. For this, oats or barley are poured with water and kept in a warm room for 24 to 48 hours. Swollen and moistened grain is scattered on shelves in a bright room and fed it a few days later when sprouts appear.

    Plants only in dried form, preferably except for the roots:

    Cabbage. causes gas formation. Do not Carrot. recommended dried form Dill. in doubt, it has a diuretic effect and, in principle, is useless (but many give it against bloating, as it is recommended even for babies) S. Peretz. just like cabbage causes gas formation Beets. although useful, but weak, so that also does not need Cucumbers. harmless, but not every beast will eat this actually aquatic vegetable. too sweet, not recommended Pears. if moderately sweet, then dried (dried. cause diarrhea) Grapes, raisins. Pts is sweet, but you can give raisins to a female who gave birth to a sick animal or raisins. Sunflower seeds and nuts are a murder for the liver. Do not get carried away by dried apricots and prunes. they are sweet and very weak. Better give dried apples. Persimmon. contains a lot of iodine. Since in the treatment of rodents they try to avoid iodine-containing drugs, it is better not to give it. It is also sweet and has astringent properties, there may be constipation. Tea rose petals. possible, but only grown personally. Shelves can not be given, because they are processed in a bunch of chemistry.

    As a treat you can give: dried carrots and apples (a small dried slice), rose hips, hawthorn, alfalfa rings, without yeast bread (also a small slice), occasionally 1 zest (pregnant and lactating female), 1 pumpkin seed (prevention from worms ), Dried grass: Nettle leaf, Dandelion, Plantain, Clover, Alfalfa. Dry branches / leaves: apple trees, pears, currants, mountain ash, raspberries

    Tree branches are recommended, the fruits of which are seedless, for example: apple tree, birch, willow, etc. The branches are ideal for treats and for brushing teeth (must be constantly in the cage)

    List of toxic wood species not suitable for chinchillas

    Mindalabrikosbukbelaya akatsiyachorny lotosdalbergiya chernodrevesnayaklon yasenelistnyykrushinaanakardiya zapadnayakedrvishnyakashtanmeliya iranskayadrevesina citrus: lemon, orange, grapefruit and t.P.Kiparisdrevesina ebony (black) derevabuzinaevkaliptpihta, elginkgo (Chinese) hemlock (American conifer) padubgledichiya sladkayagortenziya (Tree) mozhzhevelniklavr blagorodnyydrevesina red derevamangovoe derevoklonmeskitovoe derevomirtnektarindub (suitable for treatment of diarrhea, but for a healthy animal. t constipation) oleandrpersikovoe derevososna. fresh, pressure-treated, reddish tintedicone conespistachio woodcandy sandalwoodsequoyeldeak teak woodcarving walnutcrying

    The branches of stone fruit chinchillas can not be in any case.

    The toxicologist writes that you can not give branches, bones, leaves, bark of trees belonging to the genus Prunus: cherries, cherries, plums, apricots, peaches, nectarines. They contain amygdalin glycoside (a cyanide compound), the product of the breakdown of which in the body is hydrocyanic acid. There are many recorded cases of fatal poisoning. On the other hand, there is information that the bark itself and the juice in the cambium (the layer immediately following the bark) are dangerous in the branches of the same cherry, which contain all toxic elements

    Related Post

    • How To Feed The Chinchilla What Is Possible, What Is Impossible, Nutrition After Childbirth And Feeding Babies

      Contents General feeding guidelines Dishes Do I need water How to feed chinchilla? Roughage Concentrates Succulent feed Animal feed Goodies Vitamins and…

    • How To Feed Chinchilla At Home

      Contents How to feed chinchilla at home? How to feed chinchillas at home? How to feed chinchilla? Feeding chinchillas is an important part of caring for…

    • How To Feed Chinchilla

      Contents Rodent Feeding: Chinchilla Hay Finished feed Green feed, vegetables and fruits Chinchilla cereal feed Chinchilla Treats Daily ration What can…

    • How To Feed Chinchilla At Home, What You Can Eat And What

      Contents How you can and cannot feed chinchilla. Lists of healthy and harmful foods Prohibited Products Foods that can be given in limited quantities…

    • How To Feed Chinchilla And How To Do It

      Contents Power Features Dry standard feed Dry juicy feed Nutritious daily formula How to make a diet? For those who are poorly versed in animals,…